kansascityprivateinvestigators.net
Free website and domain report on kansascityprivateinvestigators.net
Last Updated: 26th June, 2020 Update Now
Overview
Snoop Summary for kansascityprivateinvestigators.net
This is a free, basic report about kansascityprivateinvestigators.net. We are still collecting data on kansascityprivateinvestigators.net. This report was last updated 26th June, 2020.
About kansascityprivateinvestigators.net
Site Preview: | |
Title: | Kansas City Private Investigators |
Description: | |
Keywords and Tags: | |
Related Terms: | |
Fav Icon: | |
Age: | Over 9 years old |
Domain Created: | 25th January, 2015 |
Domain Updated: | 19th February, 2015 |
Domain Expires: | 25th January, 2025 |
Review
Snoop Score
Valuation
Popularity
Rank, Reach and Authority
Alexa Rank: | |
Alexa Reach: | |
SEMrush Rank (US): | |
SEMrush Authority Score: | |
Moz Domain Authority: | |
Moz Page Authority: |
Organic vs Paid (Google Ads)
Traffic
Visitors
Daily Visitors: | |
Monthly Visitors: | |
Yearly Visitors: |
Note: All visitors figures are estimates.
Visitors By Country
Revenue
Revenue
Daily Revenue: | |
Monthly Revenue: | |
Yearly Revenue: |
Note: All revenue figures are estimates.
Revenue By Country
SEO
Backlinks Analysis (SEMrush)
Top New Follow Links
Top Ranking Keywords (US)
Domain Analysis
Value | Length | |
---|---|---|
Domain: | kansascityprivateinvestigators.net | 34 |
Domain Name: | kansascityprivateinvestigators | 30 |
Extension (TLD): | net | 3 |
Expiry Check: | |
Page Speed Analysis
Average Load Time: | |
Load Time Comparison: |
PageSpeed Insights
Hosting
Server Location
Server IP Address: | 198.27.68.142 |
Continent: | |
Country: | |
Region: | |
City: | |
Longitude: | |
Latitude: | |
Currencies: | |
Languages: |
Web Hosting Provider
Name | IP Address |
---|---|
OVH Hosting, Inc. |
Registration
Domain Registrant
Private Registration: | No |
Name: | |
Organization: |
Country: | |
City: | |
State: | |
Post Code: | |
Email: | |
Phone: |
Note: Registration information is derived from various sources and may be inaccurate.
Domain Registrar
Name | IP Address |
---|---|
Go Daddy, LLC | 23.220.132.43 |
Security
Visitor Safety
Mature Content: | Not Likely |
McAfee WebAdvisor Rating: | |
WOT Rating: | |
WOT Trustworthiness: | |
WOT Child Safety: |
Note: Safety information is not guaranteed.
SSL/TLS Certificate
Issued To: | cpcontacts.kansascityprivateinvestigators.net |
Issued By: | Let's Encrypt Authority X3 |
Valid From: | 30th April, 2020 |
Valid To: | 29th July, 2020 |
Subject: | CN = cpcontacts.kansascityprivateinvestigators.net |
Hash: | d2671915 |
Issuer: | CN = Let's Encrypt Authority X3 O = Let's Encrypt S = US |
Version: | 2 |
Serial Number: | 0x03F1F5953581263EBC6523CF041B9069E742 |
Serial Number (Hex): | 03F1F5953581263EBC6523CF041B9069E742 |
Valid From: | 30th April, 2025 |
Valid To: | 29th July, 2025 |
Signature Algorithm (Short Name): | RSA-SHA256 |
Signature Algorithm (Long Name): | sha256WithRSAEncryption |
Authority Key Identifier: | keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1 |
Extended Key Usage: | TLS Web Server Authentication, TLS Web Client Authentication |
Certificate Policies: | Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org |
Authority Information Access: | OCSP - URI:http://ocsp.int-x3.letsencrypt.org CA Issuers - URI:http://cert.int-x3.letsencrypt.org/ |
SCT List: | Signed Certificate Timestamp: Version : v1 (0x0) Log ID : 5E:A7:73:F9:DF:56:C0:E7:B5:36:48:7D:D0:49:E0:32: 7A:91:9A:0C:84:A1:12:12:84:18:75:96:81:71:45:58 Timestamp : Apr 30 08:11:16.855 2020 GMT Extensions: none Signature : ecdsa-with-SHA256 30:45:02:21:00:8D:E1:A3:D2:FD:76:C8:0F:6D:CD:AB: AA:34:1E:34:C5:50:7F:55:42:44:26:36:6E:35:EA:2D: 79:A7:47:DA:97:02:20:75:1B:8F:A3:D2:25:5C:CF:83: DA:C2:4D:DD:59:DB:69:77:BD:9B:0F:EB:61:A4:50:45: 02:B5:61:30:3F:BD:EC Signed Certificate Timestamp: Version : v1 (0x0) Log ID : B2:1E:05:CC:8B:A2:CD:8A:20:4E:87:66:F9:2B:B9:8A: 25:20:67:6B:DA:FA:70:E7:B2:49:53:2D:EF:8B:90:5E Timestamp : Apr 30 08:11:16.840 2020 GMT Extensions: none Signature : ecdsa-with-SHA256 30:45:02:20:25:7D:69:9D:6F:78:A1:20:C9:2F:66:96: D1:F2:6B:24:6A:1E:63:91:4F:F7:8F:E4:A6:2C:5D:B0: BE:C1:33:06:02:21:00:DD:A9:67:F8:D3:56:5F:DE:4D: 2A:C9:5F:5E:8C:9B:79:77:05:92:FD:23:F5:F5:11:39: 35:0E:EE:AB:60:F8:1A |
Key Usage: | Digital Signature, Key Encipherment |
Basic Constraints: | CA:FALSE |
Subject Alternative Name: | DNS:cpcalendars.kansascityprivateinvestigators.net DNS:cpcontacts.kansascityprivateinvestigators.net DNS:kansascityprivateinvestigators.net DNS:mail.kansascityprivateinvestigators.net DNS:webdisk.kansascityprivateinvestigators.net DNS:webmail.kansascityprivateinvestigators.net DNS:www.kansascityprivateinvestigators.net DNS:cpanel.kansascityprivateinvestigators.net |
Technical
DNS Lookup
A Records
Host | IP Address | Class | TTL |
---|---|---|---|
kansascityprivateinvestigators.net. | 198.27.68.142 | IN | 14399 |
NS Records
Host | Nameserver | Class | TTL |
---|---|---|---|
kansascityprivateinvestigators.net. | ns2.micro-comp.net. | IN | 21599 |
kansascityprivateinvestigators.net. | ns1.micro-comp.net. | IN | 21599 |
MX Records
Priority | Host | Server | Class | TTL |
---|---|---|---|---|
0 | kansascityprivateinvestigators.net. | kansascityprivateinvestigators.net. | IN | 14399 |
SOA Records
Domain Name | Primary NS | Responsible Email | TTL |
---|---|---|---|
kansascityprivateinvestigators.net. | ns1.micro-comp.net. | info.micro-comp.com. | 21599 |
TXT Records
Host | Value | Class | TTL |
---|---|---|---|
kansascityprivateinvestigators.net. | v=spf1 | IN | 14399 |
HTTP Response Headers
HTTP-Code: | HTTP/1.1 200 OK |
Date: | 26th June, 2020 |
Server: | Apache |
Expires: | 19th November, 1981 |
Cache-Control: | no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
Content-Type: | text/html; charset=UTF-8 |
X-Powered-By: | PHP/5.6.40 |
Pragma: | no-cache |
X-Pingback: | https://kansascityprivateinvestigators.net/xmlrpc.php |
Link: | <https://kansascityprivateinvestigators.net/>; rel=shortlink |
Set-Cookie: | * |
Whois Lookup
Created: | 25th January, 2015 |
Changed: | 19th February, 2015 |
Expires: | 25th January, 2025 |
Registrar: | GoDaddy.com, LLC |
Status: | clientTransferProhibited clientUpdateProhibited clientRenewProhibited clientDeleteProhibited |
Nameservers: | ns1.micro-comp.net ns2.micro-comp.net |
Owner Name: | Registration Private |
Owner Organization: | Domains By Proxy, LLC |
Owner Street: | DomainsByProxy.com 14455 N. Hayden Road |
Owner Post Code: | 85260 |
Owner City: | Scottsdale |
Owner State: | Arizona |
Owner Country: | US |
Owner Phone: | +1.4806242599 |
Owner Email: | KANSASCITYPRIVATEINVESTIGATORS.NET@domainsbyproxy.com |
Admin Name: | Registration Private |
Admin Organization: | Domains By Proxy, LLC |
Admin Street: | DomainsByProxy.com 14455 N. Hayden Road |
Admin Post Code: | 85260 |
Admin City: | Scottsdale |
Admin State: | Arizona |
Admin Country: | US |
Admin Phone: | +1.4806242599 |
Admin Email: | KANSASCITYPRIVATEINVESTIGATORS.NET@domainsbyproxy.com |
Tech Name: | Registration Private |
Tech Organization: | Domains By Proxy, LLC |
Tech Street: | DomainsByProxy.com 14455 N. Hayden Road |
Tech Post Code: | 85260 |
Tech City: | Scottsdale |
Tech State: | Arizona |
Tech Country: | US |
Tech Phone: | +1.4806242599 |
Tech Email: | KANSASCITYPRIVATEINVESTIGATORS.NET@domainsbyproxy.com |
Full Whois: | Domain Name: KANSASCITYPRIVATEINVESTIGATORS.NET
Registry Domain ID: 1898094118_DOMAIN_NET-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2015-02-19T20:32:01Z Creation Date: 2015-01-25T14:27:27Z Registrar Registration Expiration Date: 2025-01-25T14:27:27Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 14455 N. Hayden Road Registrant City: Scottsdale Registrant State/Province: Arizona Registrant Postal Code: 85260 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: KANSASCITYPRIVATEINVESTIGATORS.NET@domainsbyproxy.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 14455 N. Hayden Road Admin City: Scottsdale Admin State/Province: Arizona Admin Postal Code: 85260 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: KANSASCITYPRIVATEINVESTIGATORS.NET@domainsbyproxy.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 14455 N. Hayden Road Tech City: Scottsdale Tech State/Province: Arizona Tech Postal Code: 85260 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: KANSASCITYPRIVATEINVESTIGATORS.NET@domainsbyproxy.com Name Server: NS1.MICRO-COMP.NET Name Server: NS2.MICRO-COMP.NET DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-06-26T02:00:00Z <<< For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en Notes: IMPORTANT: Port43 will provide the ICANN-required minimum data set per ICANN Temporary Specification, adopted 17 May 2018. Visit https://whois.godaddy.com to look up contact data for domains not covered by GDPR policy. The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database. |
Nameservers
Name | IP Address |
---|---|
ns1.micro-comp.net | 198.27.68.142 |
ns2.micro-comp.net | 198.27.68.142 |
Love W3 Snoop?